reise-ins-all.de

Hier werben oder Domain günstig kaufen

Reise ins All : Der Begriff Reise (v. althochdeutsch: risan aufstehen, sich erheben) bedeutet im Sinne der Verkehrswirtschaft die Ortsveränderung einer oder mehrerer Personen mit öffentlichen oder nicht öffentlichen Verkehrsmitteln außerhalb des Wirtschaftsverkehrs; im fremdenverkehrswirtschaftlichen Sinne die Bezeichnung für den Fremdenverkehrsvorgang als Summe der beiden Phasen \"Ortsveränderung\" (Fahrt) und Aufenthalt. Wissenschaftliche Ziele verfolgen schließlich die Forschungsreisen (auch: Expedition)...

Suchbegriffe wie Weltraumtourismus, Studienreisen, Erdumlaufbahn, Flugereignis, Besuch, Kooperation könnten z.B. auf der Domain reise-ins-all.de zum Einsatz kommen.

Suchen Sie nicht länger nach Ihren Kunden - lassen Sie sich doch einfach finden!

Details zur Domain reise-ins-all.de

Die Domain reise-ins-all.de ist eine geeignete Keyword-Domain für eine Unternehmens-Webseite, Microsite, Blog oder Online-Shop.

  • Angeboten wird die Domain reise-ins-all.de (ohne Inhalte)
  • Der Domainname "Reise-ins-all" besteht aus 13 Zeichen
  • Top-Level-Domain (TLD) DE

Themenschwerpunkte für diese Domain

Odyssee Weltraum Anousheh Ansari Ansari X-Prize Astrium Transportation Bigelow Aerospace Origin Charles Simonyi DSE-Alpha Dennis Fallstudie Genesis Gregory Laliberté online Internationale Raumstation Juri-Gagarin-Kosmonautentrainingszentrum Learjet Shuttleworth Moskau (Himmelsmechanik) Orbital Sciences Corporation American Parabelflug Energija Raumfahrt Raumschiff Richard Branson Richard Garriott Russland Petersburg (Raumschiff) SpaceDev SpaceShipOne SpaceX Adventures Suborbital Swjosdny Gorodok Südafrika Tagesschau.de Technology Review Trägerrakete Virgin Galactic Washington Weltraumhotel Sergei Polonski Rocketplane


Weitere zum Verkauf angebotene Domains


Empfehlungen



Diese Domain steht zum Verkauf und wurde vom Inhaber vorübergehend geparkt. Die hier bereitgestellten Listings kommen teilweise von dritter Seite (Suchmaschinen, Wikipedia,...) und stehen mit Domain-Inhaber in keiner Beziehung. Trotz sorgfältiger inhaltlicher Kontrolle übernimmt der Inhaber keine Haftung für die Inhalte externer Links. Für den Inhalt der verlinkten Seiten sind ausschließlich deren Betreiber verantwortlich. Bei markenrechtlichen Problemfällen wenden Sie sich bitte direkt an den Domain-Inhaber lt. WHOIS (z.B. Denic.de).